La hipertensión arterial un poco menos esencial: genética de los canales iónicos y su influencia sobre la presión arterial diastólica. Jaume Marrugat IMIM-Barcelona.

1 La hipertensión arterial un poco menos esencial: genéti...

Author: Poncio Pascual

0 downloads 0 Views

1 La hipertensión arterial un poco menos esencial: genética de los canales iónicos y su influencia sobre la presión arterial diastólica. Jaume Marrugat IMIM-Barcelona en nombre de los investigadores de la red HERACLES M Valverde UPF-Barcelona M Heras Hospital Clinic-Barcelona A López-Farré Hospital Clínico-Madrid A Segura ICSCM-Talavera JR López-López UV-CSIC-Valladolid J Sala H. J Trueta-Girona M Fiol H. Son Dureta-Palma de Mallorca Para el IV Simposio Internacional de Hipertensión Arterial y II Taller sobre Riesgo Vascular, Santa Clara, Cuba. Mayo 2008

2 La hipertensión en un paradigma antropológico y evolutivo La tensión arterial se hereda, pero sin un patrón claro  base poligénica. ¿Enfermedad de la civilización? La expresión de la HTA está influenciada por factores genéticos y ambientales

3 Justificación La prevalencia de hipertensión arterial (HTA) oscila entre 25% y 40% según los estudios poblacionales El 30% de la población española de 25 a 74 años padece HTA. Después de los 74 años la prevalencia de HTA es aun mayor La HTA se asocia a morbi-mortalidad por  Cardiopatía isquémica (riesgo atribuible: 25%)  Accidente cerebrovascular (riesgo atribuible 45%)  Insuficiencia cardiaca  Órganos diana

4 Justificación Menos del 25% de hipertensos tiene correcta- mente controladas su tensión arterial. Apenas 60% de hipertensos saben que lo son

5 Justificación Poco más del 5% de la hipertensión es Secundaria Poco más del 90% es esencial (Primaria / Idiopática)… … se conocen sus factores de riesgo ambientales, pero poco de sus mecanismos moleculares y genéticos

6 Patogénesis de la HTA esencial Ambiental  Consumo de sal  Obesidad  Consumo de alcohol  Sedentarismo  Estres psicosocial  Dieta  Consumo de potasio

7 Hipertensión Esencial Una vez descartadas las causas secundarias, la patogénesis de la HTA se conoce poco, ya que muchos órganos están involucrados en la regulación de la presión arterial:  Sistemas adrenérgicos central y periférico, renal, hormonal y vascular.

8 Justificación Entre los múltiples mecanismos de regulación del tono vascular arterial nuestro proyecto se concentra en buscar la asociación con HTA de:  Canales iónicos de potasio: dependientes de Calcio y de voltaje. de calcio: Transient Receptor Potential (TRP).  Control de los mismos por estrógenos

9 Patogénesis de la HTA esencial GENETICA  Agregación familiar de la HTA  Probablemente existe una heredabilidad multifactorial con intervención de factores genéticos y ambientales  Existen algunos casos raros monogénicos de HTA ej. Aldosteronismo glucocorticoideo

10 Patogénesis de la HTA esencial Otros factores  Desregulación del equilibrio entre débito cardiaco o de las resistencias periféricas. Alteraciones renales en la excreción de Na Alteraciones del sistema renina-aldosterona Defectos en la membrana celular con acumulación anormal de calcio en las células musculares lisas arteriales.

11 Genética de HTA esencial (AME) (GRA)

12 Genética de HTA esencial 1. Angiotensinógeno (Polimorfismos T174M, M235T, G-6A, A-20C, G-152A and G-217A ) y alpha-adducin G460W a) Ligamiento de la mutación en este locus del angiotensinogeno en parejas de hermanos hipertensos. b) Asociación de esta variante en estudios de casos y controles (interacción y haplotipos significativos). c) Diferencias en los niveles plasmáticos de angiotensinó- geno entre hipertensos con distintos genotipos: los niveles plasmáticos de angiotensinógeno correlacionan con la presencia de HTA 2. Enzima conversora de la angiotensina (Polimorf I/D??): RR de 1,59 en el estudio de Framingham (USA). 3. Otros: eNOS, receptor Beta adrenérgico, endotelina- 1, ….

13 Volume 33(4) April 1999 pp 933-936 Lack of Evidence for Association Between the Endothelial Nitric Oxide Synthase Gene and Hypertension [Scientific Contributions] Kato, Norihiro; Sugiyama, Takao; Morita, Hiroyuki; Nabika, Toru; Kurihara, Hiroki; Yamori, Yukio; Yazaki, Yoshio © 1998 American Heart Association, Inc. Volume 32(1) July 1998 pp 3-8 Endothelial Nitric Oxide Synthase Gene Is Positively Associated With Essential Hypertension [Scientific Contributions] Miyamoto, Yoshihiro; Saito, Yoshihiko; Kajiyama, Noboru; Yoshimura, Michihiro; Shimasaki, Yukio; Nakayama, Masafumi; Kamitani, Shigeki; Harada, Masaki; Ishikawa, Masahiro; Kuwahara, Koichiro; Ogawa, Emiko; Hamanaka, Ichiro; Takahashi, Nobuki; Kaneshige, Toshihiko; Teraoka, Hiroshi; Akamizu, Takashi; Azuma, Nobuyuki; Yoshimasa, Yasunao; Yoshimasa, Takaaki; Itoh, Hiroshi; Masuda, Izuru; Yasue, Hirofumi; Nakao, Kazuwa

14 Copyright © 1999 by the American Association for the Advancement of Science Volume 285(5435) 17 September 1999 pp 1929-1931 Acute Activation of Maxi-K Channels (hSlo) by Estradiol Binding to the [beta] Subunit [Research: Reports ] Valverde, Miguel A. 1* ; Rojas, Patricio 2 ; Amigo, Julio 2 ; Cosmelli, Diego 2 ; Orio, Patricio 2 ; Bahamonde, Maria I. 2 ; Mann, Giovanni E. 4 ; Vergara, Cecilia 2 ; Latorre, Ramon 2,3

15 Canal Maxi-K + K+K+ Subunidad conductora   hSlo ) Subunidad reguladora  

17 El efecto de los estrógenos sobre la función endotelial

18 Determinantes genéticos y ambientales de la disfunción vascular en la HTA Red HERACLES Hipertensión Esencial: Red de Análisis de Canales iónicos y Ligandos de Estrógenos Sintéticos

20 KCNMB1 =Human MaxiK potassium channel beta subunit, =Homo sapiens potassium large conductance calcium-activated channel, subfamily M, beta member 1 Cromosoma: 5q34 Gen : 4 exones (11.631bp) mRNA: 4 exones (1277 nt) (U25138) Cds: 3 exones (576 nt) (U25138) Proteïna: 191 aa ( VKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQY PCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFL LTGGLLIIAMVKSNQYLSILAAQK )

21 LA MUTACIÓN E65K SE ENCUENTRA EN EL LAZO EXTRACELULAR Y SUPONE UN CAMBIO DE CARGAS SNPE65K:GAG->A Glu->Lys K (E K)

23 Population-based genetic epidemiological study of the human KCNMB1 gene The four exons of KCNMB1 were amplified using polymerase chain reaction and analyzed by direct sequencing. A new single nucleotide substitution (G352A) corresponding to a glutamic acid to lysine mutation at position 65 (E65K) of the protein was found in the third exon of the KCNMB1 gene. The genotype frequencies were 78.4% for EE homozygote, 20.0 % for EK heterozygote, and 1.6% for KK homozygote subjects in a representative random population sample of 3,876 participants.

26 Riesgo de ACV y Maxi K

27 Genotype frequency at different age groups Age group 0% 20% 40% 60% 80% 100% NTHTNTHTNTHTNTHTNTHT 25-3435-4445-5455-6465-74 Genotype frequency EEAllele K E65K Genotype frequency in the study population N=546 P=1.00 N=715 P=0.716 N=717 P=0.663 N=599 P=0.032 N=489 P=0.012

28 Genotype frequency by sex and age 0% 25% 50% 75% 100% NTHTNTHTNTHTNTHT 5050 MaleFemale Genotype frequency N=789 P=0.636 N=701 P=0.106 N=852 P=0.392 N=744 P=0.002 EE Allele K NT: Normo tenses HT:Moderated or severe hypertension n =608 n =152 n =22 n =7 n =501 n =135 n =57 n =8 n =653 n =191 n =5 n =3 n =536 n =160 n =46 n =2 { "@context": "http://schema.org", "@type": "ImageObject", "contentUrl": "http://images.slideplayer.es/13/3994156/slides/slide_28.jpg", "name": "Genotype frequency by sex and age 0% 25% 50% 75% 100% NTHTNTHTNTHTNTHT 5050 MaleFemale Genotype frequency N=789 P=0.636 N=701 P=0.106 N=852 P=0.392 N=744 P=0.002 EE Allele K NT: Normo tenses HT:Moderated or severe hypertension n =608 n =152 n =22 n =7 n =501 n =135 n =57 n =8 n =653 n =191 n =5 n =3 n =536 n =160 n =46 n =2", "description": "Genotype frequency by sex and age 0% 25% 50% 75% 100% NTHTNTHTNTHTNTHT 5050 MaleFemale Genotype frequency N=789 P=0.636 N=701 P=0.106 N=852 P=0.392 N=744 P=0.002 EE Allele K NT: Normo tenses HT:Moderated or severe hypertension n =608 n =152 n =22 n =7 n =501 n =135 n =57 n =8 n =653 n =191 n =5 n =3 n =536 n =160 n =46 n =2", "width": "800" } 29 0 1 2 3 All study population Male 50Female 50 OR of K allele for HT 12 OR (95% CI) of the allele K for moderate to severe diastolic hypetension, adjusted for BMI and diabetes N=3068 P=0.022 N=788 P=0.671 N=692 P=0.066 N=847 P=0.231 N=741 P=0.012 { "@context": "http://schema.org", "@type": "ImageObject", "contentUrl": "http://images.slideplayer.es/13/3994156/slides/slide_29.jpg", "name": "0 1 2 3 All study population Male 50Female 50 OR of K allele for HT 12 OR (95% CI) of the allele K for moderate to severe diastolic hypetension, adjusted for BMI and diabetes N=3068 P=0.022 N=788 P=0.671 N=692 P=0.066 N=847 P=0.231 N=741 P=0.012", "description": "0 1 2 3 All study population Male 50Female 50 OR of K allele for HT 12 OR (95% CI) of the allele K for moderate to severe diastolic hypetension, adjusted for BMI and diabetes N=3068 P=0.022 N=788 P=0.671 N=692 P=0.066 N=847 P=0.231 N=741 P=0.012", "width": "800" } 30 0 1 2 3 5 6 Interaction between genotype and age Interaction between genotype and sex Odds Ratio Influence of the different interactions for HT Adjusted for Body Mass Index and Diabetes p=0.005 p=0.064 { "@context": "http://schema.org", "@type": "ImageObject", "contentUrl": "http://images.slideplayer.es/13/3994156/slides/slide_30.jpg", "name": "0 1 2 3 5 6 Interaction between genotype and age Interaction between genotype and sex Odds Ratio Influence of the different interactions for HT Adjusted for Body Mass Index and Diabetes p=0.005 p=0.064", "description": "0 1 2 3 5 6 Interaction between genotype and age Interaction between genotype and sex Odds Ratio Influence of the different interactions for HT Adjusted for Body Mass Index and Diabetes p=0.005 p=0.064", "width": "800" } 31 El equipo HERACLES

29 0 1 2 3 All study population Male 50Female 50 OR of K allele for HT 12 OR (95% CI) of the allele K for moderate to severe diastolic hypetension, adjusted for BMI and diabetes N=3068 P=0.022 N=788 P=0.671 N=692 P=0.066 N=847 P=0.231 N=741 P=0.012 { "@context": "http://schema.org", "@type": "ImageObject", "contentUrl": "http://images.slideplayer.es/13/3994156/slides/slide_29.jpg", "name": "0 1 2 3 All study population Male 50Female 50 OR of K allele for HT 12 OR (95% CI) of the allele K for moderate to severe diastolic hypetension, adjusted for BMI and diabetes N=3068 P=0.022 N=788 P=0.671 N=692 P=0.066 N=847 P=0.231 N=741 P=0.012", "description": "0 1 2 3 All study population Male 50Female 50 OR of K allele for HT 12 OR (95% CI) of the allele K for moderate to severe diastolic hypetension, adjusted for BMI and diabetes N=3068 P=0.022 N=788 P=0.671 N=692 P=0.066 N=847 P=0.231 N=741 P=0.012", "width": "800" } 30 0 1 2 3 5 6 Interaction between genotype and age Interaction between genotype and sex Odds Ratio Influence of the different interactions for HT Adjusted for Body Mass Index and Diabetes p=0.005 p=0.064 { "@context": "http://schema.org", "@type": "ImageObject", "contentUrl": "http://images.slideplayer.es/13/3994156/slides/slide_30.jpg", "name": "0 1 2 3 5 6 Interaction between genotype and age Interaction between genotype and sex Odds Ratio Influence of the different interactions for HT Adjusted for Body Mass Index and Diabetes p=0.005 p=0.064", "description": "0 1 2 3 5 6 Interaction between genotype and age Interaction between genotype and sex Odds Ratio Influence of the different interactions for HT Adjusted for Body Mass Index and Diabetes p=0.005 p=0.064", "width": "800" } 31 El equipo HERACLES

30 0 1 2 3 5 6 Interaction between genotype and age Interaction between genotype and sex Odds Ratio Influence of the different interactions for HT Adjusted for Body Mass Index and Diabetes p=0.005 p=0.064

31 El equipo HERACLES

La hipertensión arterial un poco menos esencial: genética de los canales iónicos y su influencia sobre la presión arterial diastólica. Jaume Marrugat IMIM-Barcelona.

Recommend Documents